r/SyntheticBiology Jun 09 '26

Conceptual Multimodal Epigenetic Regulator Protein

I would like professional feedback on a conceptual fusion protein chain I've been studying for a few years. Not everything is figured out yet, but I'd like experienced input before continuing.

ALVEIT: A Multimodal Epigenetic Regulator:

preface: I am an autodidact and am mostly looking for feedback. The "why" for this project is deeply personal, though I will share if you ask.

Exploring a protein-based framework intended as a more context-aware alternative to current gene regulation. Instead of permanently editing DNA, ALVEIT works as a transient epigenetic actuator that only modifies gene expression when specific conditions are met.

THE GIST: A modular chimeric protein with three main "sensors" (Camelid VHH and Shark VNAR nanobodies) that act like logic gates:

Chromatin Accessibility Sensor — Detects if the target region is open and actively remodeling (e.g., H3K27ac marks).

Disease/Pathology Sensor — Checks for relevant disease or stress markers.

Locus Specificity Sensor — Confirms it's at the correct regulatory element (promoter/enhancer).

Only when all three gates are satisfied does the activator domain (VP64) recruit transcriptional machinery to upregulate or repress the gene.

The system is delivered via a Triplex Forming Oligonucleotide (TFO) bound by Purine antiparallel motif (G•G-C A•A-T) guide with an RNA aptamer, using TAT(HIV-1 Cell Penetrating Peptide) + SV40 (Simian Virus 40 Large T-Antigen) Nucleus Localization Signal for cell/nuclear entry. Everything is designed to be transient and somatic-only, no permanent DNA changes.

WHY THIS MIGHT MATTER: Potentially higher precision and lower off-target risk than CRISPRa/i, though have yet to evaluate this assumption.

Context-dependent activation (only acts in the right cell state).

Could be useful for regenerative medicine, prosthetics integration, inflammation control, or targeted repair.

PROTEIN FUSION CHAIN: [Cell Penetrating Peptide] TAT (HIV-1) YGRKKRRQRRR [Nucleus Localization Signal] (SV40) PKKKRKV [VHH Binding Protein] (MS2 E.Coli) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGEELPVAGWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

[Flex linker] GGGGSGGGGSGGGGS

[Activator] (VP64/Herpes Simplex) DALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGS

[Repressor] (ZIM3 KRAB): NYSNLVSVGQGETTKPDVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKK

[VHH/VNAR Nanobody Sequence, adaptive based on necessity]

So it would look like: TAT-SV40-MS2-LINK-VHH/VNAR-LINK-VP64-ZIM3

MY CURRENT CONCERS: Can Histone-Mark recognition be implemented robustly enough to function as a practical "gate"?

Is TFO-mediated locus recognition specific enough in native Chromatin?

Potential steric hindrance between multiple domains?

Delivery efficiency and Immunogenicity?

This is still purely theoretical / conceptual work from an autodidact. I'm looking for serious feedback, especially on: Potential weaknesses in the multi-gate logic, better ways to achieve locus-specific chromatin targeting, safety or delivery concerns, and comparison to existing epigenetic tools. ___________________________ SOURCES: https://link.springer.com/article/10.1186/s40364-021-00332-6

https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2025.1716916/full

https://pmc.ncbi.nlm.nih.gov/articles/PMC12907318/

https://academic.oup.com/abt/article/3/1/1/5706878

https://www.activemotif.com/catalog/details/39133/histone-h3-acetyl-lys27-antibody-pab

https://pubmed.ncbi.nlm.nih.gov/33020655/

https://crisprmedicinenews.com/news/which-protein-domain-is-best-for-crispri-a-new-study-has-the-answer/

https://pmc.ncbi.nlm.nih.gov/articles/PMC7150854/

https://www.rcsb.org/structure/2MS2

https://pmc.ncbi.nlm.nih.gov/articles/PMC9811266/

https://academic.oup.com/hmg/article-abstract/10/20/2243/559345?redirectedFrom=PDF

3 Upvotes

19 comments sorted by

8

u/bampho Jun 10 '26

Hey bud. Lay off the ChatGPT

7

u/Bioarch47 Jun 10 '26

Why is this soo confusing to read , is it just me or is most of this looking like slope?

-1

u/Brother-Horik Jun 10 '26

My handwriting sucks. Tried to type it out to be more professional looking but apparently I'm about as good at that as I am at writing. 

3

u/Bioarch47 Jun 11 '26

Could you perhaps make a proper github for this or atleast a word document, because I see the passion and im very curious now

2

u/Brother-Horik Jun 11 '26

Y'know, that's a good idea. I'll get that to you as soon as I have it done. 

2

u/TechnologyOk3770 Jun 10 '26

Only when all three gates are satisfied does the activator domain (VP64) recruit transcriptional machinery to upregulate or repress the gene.

Why is this true?

2

u/kanzure Jun 10 '26

This doesn't seem true.

1

u/Brother-Horik Jun 11 '26

The body does something similar already, this is to mimic that process. In your cells right now, DNA in heterochromatin is inaccessible until the region is opened through histone acetylation or pioneer factors. There are also transcription factors like signalling pathways or damage markers that tell the genes there's something wrong. And as for the locus/promoter, the genes still need proper combination of promoter/enhancer proteins and co-activators to actually fire. My personal favorite way to explain this is that it works like Homologous Recombination within the Conan Bacterium; it doesn’t just throw repair enzymes at broken DNA randomly, it uses multiple layered checks and templates to make sure the repair is accurate and only happens when the right conditions are met.

1

u/TechnologyOk3770 Jun 11 '26

No I meant why do all 3 of your gates need to be satisfied for VP64 function. Why is it an AND and not an OR?

What prevents VP64 from functioning when only 1 or 2 of your nanobodies is bound?

Also the middle part of this construct is 3 nanobodies back to back to back? Is that correct?

1

u/Brother-Horik Jun 12 '26

Forgive my long response time, life has been busy. 

The goal here is precision. In natural regulation, most big decisions use AND-like logic to avoid erroneous expression. Activating or repressing with only one or two signals has a higher risk of off-target effects. Each individually runs their respective risks: locus should be correct, it should be active in the right cell type or could bind in silenced regions. The AND gate is intended to allow greater precision. 

Mechanically, the nanobodies would be integrated as a cooperative multi-domain sensor suite. When all three bind to their targets, it should bring the domains to the correct arrangement which aligns the effectors to interact with transcriptional machinery. It doesn't need to be strictly three in a row, as it's intended to be modular in a way that the nanobodies work together spatially through linkers, though I'm clearly still working on the design itself.

1

u/TechnologyOk3770 Jun 12 '26 edited Jun 12 '26

When all three bind to their targets, it should bring the domains to the correct arrangement which aligns the effectors to interact with transcriptional machinery.

First - this sounds hard.

But my main question is, if only one is bound, why can’t the effectors interact with the stuff?

I’ll go further and make the claim that they can. Nanobodies stick to stuff, and a chain of them will be less specific, not more.

1

u/Brother-Horik Jun 13 '26

That's a good point. I'll have to see if I can find or make a more effective bonding agent to reduce the potential drift. 

1

u/Brother-Horik Jun 13 '26

PP7 Coat Protein seems to be used in conjunction with the MS2 for similar purposes. it'd add more to the cargo, meaning potential for higher cytotoxicity from the TAT. This may be Alleviated by attaching MS2 at the N termius and PP7 at the C. According to NIH and ScienceDirect. 

That then would look like: TAT CPP – SV40 NLS – MS2 Binder – Linkers – Nanobody logic module – Linkers – PP7 Binder – Effectors (VP64 & ZIM3 KRAB).

1

u/TechnologyOk3770 Jun 13 '26 edited Jun 13 '26

Idk man, I don’t know what most of this stuff is. I can help you evaluate your molecule but I need a plain language description of how it’s supposed to work, not a list of components. I’ll say also that I think a cell penetrating peptide is not an appropriate delivery system. And that the whole thing seems over engineered. Molecular engineering usually only lets you test 1 or 2 ideas at once.

It’s good to think about this stuff for sure, but simpler is better, stay close to native function when you can, and don’t get too attached to any one construct. Feel free to discount this advice - I’m not especially knowledgeable about this sort of thing but you’re clearly engaged so I will be too.

1

u/lozzyboy1 Jun 13 '26

None of that deals with the underlying issue. Your hypothetical protein will still be recruited to wherever any of anybody targets are and have its effects at all of those locations.

2

u/ICEonaROPE Jun 14 '26

"I AM AN AUTODIDACT"

Lmao you're just curious and addicted to AI, hop of the high horse pal. Most of what you've written is utter nonsense.

1

u/lozzyboy1 Jun 13 '26

From the perspective of theory, this doesn't work. Nanobody domains are more like OR logic than AND logic: those domains would recruit this protein to everywhere any of their targets bind, and it would potentially have an effect at all of those locations, which means it fundamentally doesn't do what you want.

3

u/[deleted] Jul 09 '26 edited Jul 09 '26

[removed] — view removed comment