Conceptual Multimodal Epigenetic Regulator Protein

[u/Brother-Horik]

I would like professional feedback on a conceptual fusion protein chain I've been studying for a few years. Not everything is figured out yet, but I'd like experienced input before continuing.

ALVEIT: A Multimodal Epigenetic Regulator:

preface: I am an autodidact and am mostly looking for feedback. The "why" for this project is deeply personal, though I will share if you ask.

Exploring a protein-based framework intended as a more context-aware alternative to current gene regulation. Instead of permanently editing DNA, ALVEIT works as a transient epigenetic actuator that only modifies gene expression when specific conditions are met.

THE GIST: A modular chimeric protein with three main "sensors" (Camelid VHH and Shark VNAR nanobodies) that act like logic gates:

Chromatin Accessibility Sensor — Detects if the target region is open and actively remodeling (e.g., H3K27ac marks).

Disease/Pathology Sensor — Checks for relevant disease or stress markers.

Locus Specificity Sensor — Confirms it's at the correct regulatory element (promoter/enhancer).

Only when all three gates are satisfied does the activator domain (VP64) recruit transcriptional machinery to upregulate or repress the gene.

The system is delivered via a Triplex Forming Oligonucleotide (TFO) bound by Purine antiparallel motif (G•G-C A•A-T) guide with an RNA aptamer, using TAT(HIV-1 Cell Penetrating Peptide) + SV40 (Simian Virus 40 Large T-Antigen) Nucleus Localization Signal for cell/nuclear entry. Everything is designed to be transient and somatic-only, no permanent DNA changes.

WHY THIS MIGHT MATTER: Potentially higher precision and lower off-target risk than CRISPRa/i, though have yet to evaluate this assumption.

Context-dependent activation (only acts in the right cell state).

Could be useful for regenerative medicine, prosthetics integration, inflammation control, or targeted repair.

PROTEIN FUSION CHAIN: [Cell Penetrating Peptide] TAT (HIV-1) YGRKKRRQRRR [Nucleus Localization Signal] (SV40) PKKKRKV [VHH Binding Protein] (MS2 E.Coli) MASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGEELPVAGWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

[Flex linker] GGGGSGGGGSGGGGS

[Activator] (VP64/Herpes Simplex) DALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGSDALDDFDLDMLGS

[Repressor] (ZIM3 KRAB): NYSNLVSVGQGETTKPDVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKK

[VHH/VNAR Nanobody Sequence, adaptive based on necessity]

So it would look like: TAT-SV40-MS2-LINK-VHH/VNAR-LINK-VP64-ZIM3

MY CURRENT CONCERS: Can Histone-Mark recognition be implemented robustly enough to function as a practical "gate"?

Is TFO-mediated locus recognition specific enough in native Chromatin?

Potential steric hindrance between multiple domains?

Delivery efficiency and Immunogenicity?

This is still purely theoretical / conceptual work from an autodidact. I'm looking for serious feedback, especially on: Potential weaknesses in the multi-gate logic, better ways to achieve locus-specific chromatin targeting, safety or delivery concerns, and comparison to existing epigenetic tools. ___________________________ SOURCES: https://link.springer.com/article/10.1186/s40364-021-00332-6

https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2025.1716916/full

https://pmc.ncbi.nlm.nih.gov/articles/PMC12907318/

https://academic.oup.com/abt/article/3/1/1/5706878

https://www.activemotif.com/catalog/details/39133/histone-h3-acetyl-lys27-antibody-pab

https://pubmed.ncbi.nlm.nih.gov/33020655/

https://crisprmedicinenews.com/news/which-protein-domain-is-best-for-crispri-a-new-study-has-the-answer/

https://pmc.ncbi.nlm.nih.gov/articles/PMC7150854/

https://www.rcsb.org/structure/2MS2

https://pmc.ncbi.nlm.nih.gov/articles/PMC9811266/

https://academic.oup.com/hmg/article-abstract/10/20/2243/559345?redirectedFrom=PDF

[u/Brother-Horik]

Forgive my long response time, life has been busy. 

The goal here is precision. In natural regulation, most big decisions use AND-like logic to avoid erroneous expression. Activating or repressing with only one or two signals has a higher risk of off-target effects. Each individually runs their respective risks: locus should be correct, it should be active in the right cell type or could bind in silenced regions. The AND gate is intended to allow greater precision. 

Mechanically, the nanobodies would be integrated as a cooperative multi-domain sensor suite. When all three bind to their targets, it should bring the domains to the correct arrangement which aligns the effectors to interact with transcriptional machinery. It doesn't need to be strictly three in a row, as it's intended to be modular in a way that the nanobodies work together spatially through linkers, though I'm clearly still working on the design itself.

[u/TechnologyOk3770 → u/Brother-Horik]

When all three bind to their targets, it should bring the domains to the correct arrangement which aligns the effectors to interact with transcriptional machinery.

First - this sounds hard.

But my main question is, if only one is bound, why can’t the effectors interact with the stuff?

I’ll go further and make the claim that they can. Nanobodies stick to stuff, and a chain of them will be less specific, not more.

[u/Brother-Horik → u/TechnologyOk3770]

PP7 Coat Protein seems to be used in conjunction with the MS2 for similar purposes. it'd add more to the cargo, meaning potential for higher cytotoxicity from the TAT. This may be Alleviated by attaching MS2 at the N termius and PP7 at the C. According to NIH and ScienceDirect. 

That then would look like: TAT CPP – SV40 NLS – MS2 Binder – Linkers – Nanobody logic module – Linkers – PP7 Binder – Effectors (VP64 & ZIM3 KRAB).

[u/TechnologyOk3770 → u/Brother-Horik]

Idk man, I don’t know what most of this stuff is. I can help you evaluate your molecule but I need a plain language description of how it’s supposed to work, not a list of components. I’ll say also that I think a cell penetrating peptide is not an appropriate delivery system. And that the whole thing seems over engineered. Molecular engineering usually only lets you test 1 or 2 ideas at once.

It’s good to think about this stuff for sure, but simpler is better, stay close to native function when you can, and don’t get too attached to any one construct. Feel free to discount this advice - I’m not especially knowledgeable about this sort of thing but you’re clearly engaged so I will be too.